Anti-SERPINA4 pAb (ATL-HPA068939)

Atlas Antibodies

Catalog No.:
ATL-HPA068939-100
Immunofluorescent staining of human cell line Hep-G2 shows localization to vesicles.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human SERPINA4, Gene description: serpin family A member 4, Alternative Gene Names: KAL, KLST, KST, PI4, Validated applications: ICC, WB, Uniprot ID: P29622, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET
Gene Sequence HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET
Gene ID - Mouse ENSMUSG00000041550
Gene ID - Rat ENSRNOG00000009788
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-SERPINA4 pAb (ATL-HPA068939)
Vendor Page Anti-SERPINA4 pAb (ATL-HPA068939) at Atlas Antibodies

Documents & Links for Anti-SERPINA4 pAb (ATL-HPA068939)
Vendor Page Anti-SERPINA4 pAb (ATL-HPA068939)
!