Anti SEPT10 pAb (ATL-HPA047860 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA047860-25

Protein Description: septin 10
Gene Name: SEPT10
Alternative Gene Name: FLJ11619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046541: 31%, ENSRNOG00000004696: 31%
Entrez Gene ID: 151011
Uniprot ID: Q9P0V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
• Gene Sequence: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG
• Gene ID - Mouse: ENSMUSG00000046541
• Gene ID - Rat: ENSRNOG00000004696
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.