Anti SDPR pAb (ATL-HPA062122)

Atlas Antibodies

SKU: ATL-HPA062122-25

• 

Protein Description: serum deprivation response
Gene Name: SDPR
Alternative Gene Name: cavin-2, CAVIN2, PS-p68, SDR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045954: 91%, ENSRNOG00000025895: 90%
Entrez Gene ID: 8436
Uniprot ID: O95810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLT
• Gene Sequence: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLT
• Gene ID - Mouse: ENSMUSG00000045954
• Gene ID - Rat: ENSRNOG00000025895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.