Anti SDE2 pAb (ATL-HPA031255)

Atlas Antibodies

Catalog No.: ATL-HPA031255-25

Protein Description: SDE2 telomere maintenance homolog (S. pombe)
Gene Name: SDE2
Alternative Gene Name: C1orf55, FLJ35382
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038806: 37%, ENSRNOG00000003247: 40%
Entrez Gene ID: 163859
Uniprot ID: Q6IQ49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMA
• Gene Sequence: ETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMA
• Gene ID - Mouse: ENSMUSG00000038806
• Gene ID - Rat: ENSRNOG00000003247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDE2 pAb (ATL-HPA031255) – 2 Found

Rageul, Julie; Park, Jennifer J; Zeng, Ping Ping; Lee, Eun-A; Yang, Jihyeon; Hwang, Sunyoung; Lo, Natalie; Weinheimer, Alexandra S; Schärer, Orlando D; Yeo, Jung-Eun; Kim, Hyungjin. SDE2 integrates into the TIMELESS-TIPIN complex to protect stalled replication forks. Nature Communications. 2020;11(1):5495. 

Weinheimer, Alexandra S; Paung, YiTing; Rageul, Julie; Khan, Arafat; Lo, Natalie; Ho, Brian; Tong, Michael; Alphonse, Sébastien; Seeliger, Markus A; Kim, Hyungjin. Extended DNA-binding interfaces beyond the canonical SAP domain contribute to the function of replication stress regulator SDE2 at DNA replication forks. The Journal Of Biological Chemistry. 2022;298(8):102268.