Anti SDCCAG8 pAb (ATL-HPA044477)

Atlas Antibodies

Catalog No.: ATL-HPA044477-25

Protein Description: serologically defined colon cancer antigen 8
Gene Name: SDCCAG8
Alternative Gene Name: BBS16, CCCAP, NPHP10, NY-CO-8, SLSN7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026504: 79%, ENSRNOG00000004181: 76%
Entrez Gene ID: 10806
Uniprot ID: Q86SQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSAL
• Gene Sequence: QLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSAL
• Gene ID - Mouse: ENSMUSG00000026504
• Gene ID - Rat: ENSRNOG00000004181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.