Anti SDCBP2 pAb (ATL-HPA064490 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064490-25

• 

Protein Description: syndecan binding protein 2
Gene Name: SDCBP2
Alternative Gene Name: SITAC18, ST-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027456: 69%, ENSRNOG00000009528: 69%
Entrez Gene ID: 27111
Uniprot ID: Q9H190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCK
• Gene Sequence: VQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCK
• Gene ID - Mouse: ENSMUSG00000027456
• Gene ID - Rat: ENSRNOG00000009528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.