Anti SDAD1 pAb (ATL-HPA035949)

Atlas Antibodies

Catalog No.: ATL-HPA035949-25

Protein Description: SDA1 domain containing 1
Gene Name: SDAD1
Alternative Gene Name: FLJ10498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029415: 99%, ENSRNOG00000022229: 99%
Entrez Gene ID: 55153
Uniprot ID: Q9NVU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARVQEYGEL
• Gene Sequence: VGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARVQEYGEL
• Gene ID - Mouse: ENSMUSG00000029415
• Gene ID - Rat: ENSRNOG00000022229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.