Anti SCLT1 pAb (ATL-HPA036561)

Atlas Antibodies

Catalog No.: ATL-HPA036561-25

Protein Description: sodium channel and clathrin linker 1
Gene Name: SCLT1
Alternative Gene Name: FLJ30655, hCAP-1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059834: 73%, ENSRNOG00000014139: 73%
Entrez Gene ID: 132320
Uniprot ID: Q96NL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
• Gene Sequence: KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE
• Gene ID - Mouse: ENSMUSG00000059834
• Gene ID - Rat: ENSRNOG00000014139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCLT1 pAb (ATL-HPA036561) – 4 Found

Katagiri, Satoshi; Hayashi, Takaaki; Yoshitake, Kazutoshi; Murai, Noriyuki; Matsui, Zenichi; Kubo, Hiroyuki; Satoh, Hiroyuki; Matsufuji, Senya; Takamura, Tsuyoshi; Yokoo, Takashi; Omori, Yoshihiro; Furukawa, Takahisa; Iwata, Takeshi; Nakano, Tadashi. Compound heterozygous splice site variants in the SCLT1 gene highlight an additional candidate locus for Senior-Løken syndrome. Scientific Reports. 2018;8(1):16733. 

Bowler, Mathew; Kong, Dong; Sun, Shufeng; Nanjundappa, Rashmi; Evans, Lauren; Farmer, Veronica; Holland, Andrew; Mahjoub, Moe R; Sui, Haixin; Loncarek, Jadranka. High-resolution characterization of centriole distal appendage morphology and dynamics by correlative STORM and electron microscopy. Nature Communications. 2019;10(1):993. 

Kong, Dong; Farmer, Veronica; Shukla, Anil; James, Jana; Gruskin, Richard; Kiriyama, Shigeo; Loncarek, Jadranka. Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles. The Journal Of Cell Biology. 2014;206(7):855-65. 

Viol, Linda; Hata, Shoji; Pastor-Peidro, Ana; Neuner, Annett; Murke, Florian; Wuchter, Patrick; Ho, Anthony D; Giebel, Bernd; Pereira, Gislene. Nek2 kinase displaces distal appendages from the mother centriole prior to mitosis. The Journal Of Cell Biology. 2020;219(3)