Anti SCEL pAb (ATL-HPA040154 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040154-25

Protein Description: sciellin
Gene Name: SCEL
Alternative Gene Name: FLJ21667, MGC22531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022123: 50%, ENSRNOG00000024237: 49%
Entrez Gene ID: 8796
Uniprot ID: O95171
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVTPEVKRSNQGSKDLNNFIKVYPGTEKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDE
• Gene Sequence: KVTPEVKRSNQGSKDLNNFIKVYPGTEKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDE
• Gene ID - Mouse: ENSMUSG00000022123
• Gene ID - Rat: ENSRNOG00000024237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.