Anti SCAF1 pAb (ATL-HPA054593)

Atlas Antibodies

Catalog No.: ATL-HPA054593-25

Protein Description: SR-related CTD-associated factor 1
Gene Name: SCAF1
Alternative Gene Name: FLJ00034, SR-A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038406: 94%, ENSRNOG00000056946: 95%
Entrez Gene ID: 58506
Uniprot ID: Q9H7N4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PASRVSQLPTLPPPMPWNLPAGVDCTTSGVLALTALLFKMEEANLASRAKAQELIQATNQILSHRKPPSSLGMTPAPVPTSLGLP
• Gene Sequence: PASRVSQLPTLPPPMPWNLPAGVDCTTSGVLALTALLFKMEEANLASRAKAQELIQATNQILSHRKPPSSLGMTPAPVPTSLGLP
• Gene ID - Mouse: ENSMUSG00000038406
• Gene ID - Rat: ENSRNOG00000056946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.