Anti SARNP pAb (ATL-HPA030903)

Atlas Antibodies

Catalog No.: ATL-HPA030903-25

Protein Description: SAP domain containing ribonucleoprotein
Gene Name: SARNP
Alternative Gene Name: CIP29, Hcc-1, THO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078427: 94%, ENSRNOG00000030520: 94%
Entrez Gene ID: 84324
Uniprot ID: P82979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGL
• Gene Sequence: KPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGL
• Gene ID - Mouse: ENSMUSG00000078427
• Gene ID - Rat: ENSRNOG00000030520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.