Anti SAMD4A pAb (ATL-HPA065309)

Atlas Antibodies

Catalog No.: ATL-HPA065309-25

Protein Description: sterile alpha motif domain containing 4A
Gene Name: SAMD4A
Alternative Gene Name: DKFZP434H0350, hSmaug1, KIAA1053, SAMD4, Smaug, SMG, SMGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021838: 90%, ENSRNOG00000010489: 90%
Entrez Gene ID: 23034
Uniprot ID: Q9UPU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN
• Gene Sequence: PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN
• Gene ID - Mouse: ENSMUSG00000021838
• Gene ID - Rat: ENSRNOG00000010489
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SAMD4A pAb (ATL-HPA065309) – 1 Found

Ahn, Jinsoo; Kim, Dong-Hwan; Park, Mi-Ryung; Suh, Yeunsu; Lee, Haesun; Hwang, Seongsoo; Mamuad, Lovelia L; Lee, Sang Suk; Lee, Kichoon. A novel testis-enriched gene, Samd4a, regulates spermatogenesis as a spermatid-specific factor. Frontiers In Cell And Developmental Biology. 10( 36274854):978343.