Anti SAMD10 pAb (ATL-HPA040973)

Atlas Antibodies

Catalog No.: ATL-HPA040973-25

Protein Description: sterile alpha motif domain containing 10
Gene Name: SAMD10
Alternative Gene Name: C20orf136
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038605: 90%, ENSRNOG00000036719: 89%
Entrez Gene ID: 140700
Uniprot ID: Q9BYL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTS
• Gene Sequence: MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTS
• Gene ID - Mouse: ENSMUSG00000038605
• Gene ID - Rat: ENSRNOG00000036719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.