Anti RUNX1T1 pAb (ATL-HPA049852)

Atlas Antibodies

Catalog No.: ATL-HPA049852-25

Protein Description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Gene Name: RUNX1T1
Alternative Gene Name: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006586: 98%, ENSRNOG00000005673: 96%
Entrez Gene ID: 862
Uniprot ID: Q06455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
• Gene Sequence: KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE
• Gene ID - Mouse: ENSMUSG00000006586
• Gene ID - Rat: ENSRNOG00000005673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.