Anti RUFY2 pAb (ATL-HPA039792)

Atlas Antibodies

Catalog No.: ATL-HPA039792-25

Protein Description: RUN and FYVE domain containing 2
Gene Name: RUFY2
Alternative Gene Name: FLJ10063, KIAA1537, RABIP4R, ZFYVE13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020070: 89%, ENSRNOG00000059663: 95%
Entrez Gene ID: 55680
Uniprot ID: Q8WXA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
• Gene Sequence: EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
• Gene ID - Mouse: ENSMUSG00000020070
• Gene ID - Rat: ENSRNOG00000059663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.