Anti RSPH4A pAb (ATL-HPA031196 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031196-25

Protein Description: radial spoke head 4 homolog A (Chlamydomonas)
Gene Name: RSPH4A
Alternative Gene Name: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039552: 41%, ENSRNOG00000058561: 37%
Entrez Gene ID: 345895
Uniprot ID: Q5TD94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
• Gene Sequence: RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
• Gene ID - Mouse: ENSMUSG00000039552
• Gene ID - Rat: ENSRNOG00000058561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RSPH4A pAb (ATL-HPA031196 w/enhanced validation) – 7 Found

Frommer, Adrien; Hjeij, Rim; Loges, Niki T; Edelbusch, Christine; Jahnke, Charlotte; Raidt, Johanna; Werner, Claudius; Wallmeier, Julia; Große-Onnebrink, Jörg; Olbrich, Heike; Cindrić, Sandra; Jaspers, Martine; Boon, Mieke; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Marthin, June K; Nielsen, Kim G; Amirav, Israel; Elias, Nael; Kerem, Eitan; Shoseyov, David; Haeffner, Karsten; Omran, Heymut. Immunofluorescence Analysis and Diagnosis of Primary Ciliary Dyskinesia with Radial Spoke Defects. American Journal Of Respiratory Cell And Molecular Biology. 2015;53(4):563-73. 

Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. 

Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. 

Jeanson, Ludovic; Copin, Bruno; Papon, Jean-François; Dastot-Le Moal, Florence; Duquesnoy, Philippe; Montantin, Guy; Cadranel, Jacques; Corvol, Harriet; Coste, André; Désir, Julie; Souayah, Anissa; Kott, Esther; Collot, Nathalie; Tissier, Sylvie; Louis, Bruno; Tamalet, Aline; de Blic, Jacques; Clement, Annick; Escudier, Estelle; Amselem, Serge; Legendre, Marie. RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes. American Journal Of Human Genetics. 2015;97(1):153-62. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) 

Wang, Lin; Wang, Rongchun; Yang, Danhui; Lu, Chenyang; Xu, Yingjie; Liu, Ying; Guo, Ting; Lei, Cheng; Luo, Hong. Novel RSPH4A Variants Associated With Primary Ciliary Dyskinesia-Related Infertility in Three Chinese Families. Frontiers In Genetics. 13( 35812741):922287. 

Schultz, Rüdiger; Elenius, Varpu; Fassad, Mahmoud R; Freke, Grace; Rogers, Andrew; Shoemark, Amelia; Koistinen, Tiina; Mohamed, Mai A; Lim, Jacqueline S Y; Mitchison, Hannah M; Sironen, Anu I. CFAP300 mutation causing primary ciliary dyskinesia in Finland. Frontiers In Genetics. 13( 36246608):985227.