Anti RSBN1 pAb (ATL-HPA042124)

Atlas Antibodies

Catalog No.: ATL-HPA042124-25

Protein Description: round spermatid basic protein 1
Gene Name: RSBN1
Alternative Gene Name: FLJ11220, ROSBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044098: 96%, ENSRNOG00000019671: 96%
Entrez Gene ID: 54665
Uniprot ID: Q5VWQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALV
• Gene Sequence: KEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALV
• Gene ID - Mouse: ENSMUSG00000044098
• Gene ID - Rat: ENSRNOG00000019671
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.