Anti RRP8 pAb (ATL-HPA038487)

Atlas Antibodies

Catalog No.: ATL-HPA038487-25

Protein Description: ribosomal RNA processing 8, methyltransferase, homolog (yeast)
Gene Name: RRP8
Alternative Gene Name: KIAA0409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030888: 93%, ENSRNOG00000018766: 92%
Entrez Gene ID: 23378
Uniprot ID: O43159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNSVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFC
• Gene Sequence: AQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNSVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFC
• Gene ID - Mouse: ENSMUSG00000030888
• Gene ID - Rat: ENSRNOG00000018766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.