Anti RPUSD3 pAb (ATL-HPA037551)

Atlas Antibodies

Catalog No.: ATL-HPA037551-25

Protein Description: RNA pseudouridylate synthase domain containing 3
Gene Name: RPUSD3
Alternative Gene Name: MGC29784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051169: 83%, ENSRNOG00000009084: 84%
Entrez Gene ID: 285367
Uniprot ID: Q6P087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHMVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHLTPSQAAQLPLHLHLHRLLLPGTR
• Gene Sequence: VHMVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHLTPSQAAQLPLHLHLHRLLLPGTR
• Gene ID - Mouse: ENSMUSG00000051169
• Gene ID - Rat: ENSRNOG00000009084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.