Anti RPUSD2 pAb (ATL-HPA042194 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042194-25

Protein Description: RNA pseudouridylate synthase domain containing 2
Gene Name: RPUSD2
Alternative Gene Name: C15orf19, C18B11, FLJ31409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027324: 92%, ENSRNOG00000046797: 95%
Entrez Gene ID: 27079
Uniprot ID: Q8IZ73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELH
• Gene Sequence: VFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVIFILGKEHQLKELH
• Gene ID - Mouse: ENSMUSG00000027324
• Gene ID - Rat: ENSRNOG00000046797
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.