Anti RPS25 pAb (ATL-HPA031801)

Atlas Antibodies

Catalog No.: ATL-HPA031801-25

Protein Description: ribosomal protein S25
Gene Name: RPS25
Alternative Gene Name: S25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000047151: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
• Gene Sequence: VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
• Gene ID - Mouse: ENSMUSG00000009927
• Gene ID - Rat: ENSRNOG00000047151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPS25 pAb (ATL-HPA031801) – 2 Found

Hien, Annie; Molinaro, Gemma; Liu, Botao; Huber, Kimberly M; Richter, Joel D. Ribosome profiling in mouse hippocampus: plasticity-induced regulation and bidirectional control by TSC2 and FMRP. Molecular Autism. 2020;11(1):78. 

Genuth, Naomi R; Shi, Zhen; Kunimoto, Koshi; Hung, Victoria; Xu, Adele F; Kerr, Craig H; Tiu, Gerald C; Oses-Prieto, Juan A; Salomon-Shulman, Rachel E A; Axelrod, Jeffrey D; Burlingame, Alma L; Loh, Kyle M; Barna, Maria. A stem cell roadmap of ribosome heterogeneity reveals a function for RPL10A in mesoderm production. Nature Communications. 2022;13(1):5491.