Anti RPL34 pAb (ATL-HPA035139)

Atlas Antibodies

Catalog No.: ATL-HPA035139-25

Protein Description: ribosomal protein L34
Gene Name: RPL34
Alternative Gene Name: L34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062006: 100%, ENSRNOG00000016387: 100%
Entrez Gene ID: 6164
Uniprot ID: P49207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG
• Gene Sequence: MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG
• Gene ID - Mouse: ENSMUSG00000062006
• Gene ID - Rat: ENSRNOG00000016387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.