Anti RPL17 pAb (ATL-HPA046385)

Atlas Antibodies

Catalog No.:
ATL-HPA046385-100
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ribosomal protein L17
Gene Name: RPL17
Alternative Gene Name: L17, rpL23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062328: 100%, ENSRNOG00000018680: 100%
Entrez Gene ID: 6139
Uniprot ID: P18621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
Gene Sequence RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
Gene ID - Mouse ENSMUSG00000062328
Gene ID - Rat ENSRNOG00000018680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPL17 pAb (ATL-HPA046385)
Datasheet Anti RPL17 pAb (ATL-HPA046385) Datasheet (External Link)
Vendor Page Anti RPL17 pAb (ATL-HPA046385) at Atlas Antibodies

Documents & Links for Anti RPL17 pAb (ATL-HPA046385)
Datasheet Anti RPL17 pAb (ATL-HPA046385) Datasheet (External Link)
Vendor Page Anti RPL17 pAb (ATL-HPA046385)
!