Anti RPL13A pAb (ATL-HPA038751)

Atlas Antibodies

Catalog No.: ATL-HPA038751-25

Protein Description: ribosomal protein L13a
Gene Name: RPL13A
Alternative Gene Name: L13A, TSTA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074129: 93%, ENSRNOG00000020618: 98%
Entrez Gene ID: 23521
Uniprot ID: P40429
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
• Gene Sequence: AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
• Gene ID - Mouse: ENSMUSG00000074129
• Gene ID - Rat: ENSRNOG00000020618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.