Anti RPL13 pAb (ATL-HPA051702)

Atlas Antibodies

Catalog No.: ATL-HPA051702-100

Protein Description: ribosomal protein L13
Gene Name: RPL13
Alternative Gene Name: BBC1, D16S444E, L13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000740: 99%, ENSRNOG00000059545: 97%
Entrez Gene ID: 6137
Uniprot ID: P26373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
• Gene Sequence: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD
• Gene ID - Mouse: ENSMUSG00000000740
• Gene ID - Rat: ENSRNOG00000059545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.