Anti ROBO1 pAb (ATL-HPA074461)

Atlas Antibodies

Catalog No.: ATL-HPA074461-25

Protein Description: roundabout guidance receptor 1
Gene Name: ROBO1
Alternative Gene Name: DUTT1, FLJ21882, SAX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022883: 97%, ENSRNOG00000029614: 96%
Entrez Gene ID: 6091
Uniprot ID: Q9Y6N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGD
• Gene Sequence: PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGD
• Gene ID - Mouse: ENSMUSG00000022883
• Gene ID - Rat: ENSRNOG00000029614
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.