Anti RNPEPL1 pAb (ATL-HPA036772 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036772-25

Protein Description: arginyl aminopeptidase (aminopeptidase B)-like 1
Gene Name: RNPEPL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026269: 84%, ENSRNOG00000045775: 80%
Entrez Gene ID: 57140
Uniprot ID: Q9HAU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASEPSTELGKAEADTDSDAQALLLGDEAPSSAISLRDVNVSA
• Gene Sequence: LEVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASEPSTELGKAEADTDSDAQALLLGDEAPSSAISLRDVNVSA
• Gene ID - Mouse: ENSMUSG00000026269
• Gene ID - Rat: ENSRNOG00000045775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.