Anti RNF186 pAb (ATL-HPA035558 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035558-25

Protein Description: ring finger protein 186
Gene Name: RNF186
Alternative Gene Name: FLJ20225
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070661: 58%, ENSRNOG00000017244: 58%
Entrez Gene ID: 54546
Uniprot ID: Q9NXI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
• Gene Sequence: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
• Gene ID - Mouse: ENSMUSG00000070661
• Gene ID - Rat: ENSRNOG00000017244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.