Anti RNASE12 pAb (ATL-HPA044175 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044175-25

Protein Description: ribonuclease, RNase A family, 12 (non-active)
Gene Name: RNASE12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068407: 69%, ENSRNOG00000042612: 72%
Entrez Gene ID: 493901
Uniprot ID: Q5GAN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPDSFLGYV
• Gene Sequence: INGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPDSFLGYV
• Gene ID - Mouse: ENSMUSG00000068407
• Gene ID - Rat: ENSRNOG00000042612
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.