Anti RMND1 pAb (ATL-HPA031397)

Atlas Antibodies

Catalog No.: ATL-HPA031397-25

Protein Description: required for meiotic nuclear division 1 homolog (S. cerevisiae)
Gene Name: RMND1
Alternative Gene Name: bA351K16.3, C6orf96, FLJ20627, RMD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019763: 84%, ENSRNOG00000019501: 82%
Entrez Gene ID: 55005
Uniprot ID: Q9NWS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQ
• Gene Sequence: RRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQ
• Gene ID - Mouse: ENSMUSG00000019763
• Gene ID - Rat: ENSRNOG00000019501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.