Anti RLBP1 pAb (ATL-HPA042051 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042051-25

Protein Description: retinaldehyde binding protein 1
Gene Name: RLBP1
Alternative Gene Name: CRALBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039194: 91%, ENSRNOG00000016897: 92%
Entrez Gene ID: 6017
Uniprot ID: P12271
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRL
• Gene Sequence: TTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRL
• Gene ID - Mouse: ENSMUSG00000039194
• Gene ID - Rat: ENSRNOG00000016897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.