Anti RITA1 pAb (ATL-HPA039094)

Atlas Antibodies

Catalog No.: ATL-HPA039094-25

Protein Description: RBPJ interacting and tubulin associated 1
Gene Name: RITA1
Alternative Gene Name: C12orf52, FLJ14827, RITA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029600: 59%, ENSRNOG00000037720: 56%
Entrez Gene ID: 84934
Uniprot ID: Q96K30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPST
• Gene Sequence: AGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPST
• Gene ID - Mouse: ENSMUSG00000029600
• Gene ID - Rat: ENSRNOG00000037720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.