Anti RIPPLY2 pAb (ATL-HPA047454)

Atlas Antibodies

Catalog No.: ATL-HPA047454-25

Protein Description: ripply transcriptional repressor 2
Gene Name: RIPPLY2
Alternative Gene Name: C6orf159, dJ237I15.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047897: 45%, ENSRNOG00000010004: 43%
Entrez Gene ID: 134701
Uniprot ID: Q5TAB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPV
• Gene Sequence: MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPV
• Gene ID - Mouse: ENSMUSG00000047897
• Gene ID - Rat: ENSRNOG00000010004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.