Anti RIPK4 pAb (ATL-HPA030942 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030942-25

Protein Description: receptor interacting serine/threonine kinase 4
Gene Name: RIPK4
Alternative Gene Name: ANKK2, ANKRD3, DIK, PKK, RIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005251: 90%, ENSRNOG00000001618: 91%
Entrez Gene ID: 54101
Uniprot ID: P57078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALD
• Gene Sequence: SGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALD
• Gene ID - Mouse: ENSMUSG00000005251
• Gene ID - Rat: ENSRNOG00000001618
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.