Anti RIN1 pAb (ATL-HPA035491)

Atlas Antibodies

Catalog No.: ATL-HPA035491-25

Protein Description: Ras and Rab interactor 1
Gene Name: RIN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024883: 39%, ENSRNOG00000050223: 40%
Entrez Gene ID: 9610
Uniprot ID: Q13671
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEP
• Gene Sequence: RLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEP
• Gene ID - Mouse: ENSMUSG00000024883
• Gene ID - Rat: ENSRNOG00000050223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RIN1 pAb (ATL-HPA035491) – 1 Found

Balaji, Kavitha; French, Christopher T; Miller, Jeff F; Colicelli, John. The RAB5-GEF function of RIN1 regulates multiple steps during Listeria monocytogenes infection. Traffic (Copenhagen, Denmark). 2014;15(11):1206-18.