Anti RHOG pAb (ATL-HPA039871 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039871-25

Protein Description: ras homolog family member G
Gene Name: RHOG
Alternative Gene Name: ARHG, MGC125835, MGC125836, RhoG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073982: 100%, ENSRNOG00000020393: 100%
Entrez Gene ID: 391
Uniprot ID: P84095
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
• Gene Sequence: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
• Gene ID - Mouse: ENSMUSG00000073982
• Gene ID - Rat: ENSRNOG00000020393
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RHOG pAb (ATL-HPA039871 w/enhanced validation) – 1 Found

Sahu, Apeksha; Kumar, Satwant; Sreenivasamurthy, Sreelakshmi K; Selvan, Lakshmi Dhevi N; Madugundu, Anil K; Yelamanchi, Soujanya D; Puttamallesh, Vinuth N; Dey, Gourav; Anil, Abhijith K; Srinivasan, Anand; Mukherjee, Kanchan K; Gowda, Harsha; Satishchandra, Parthasarathy; Mahadevan, Anita; Pandey, Akhilesh; Prasad, Thottethodi Subrahmanya Keshava; Shankar, Susarla Krishna. Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV. Clinical Proteomics. 11(1):39.