Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045780-25

Protein Description: regulator of G-protein signaling 18
Gene Name: RGS18
Alternative Gene Name: RGS13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026357: 83%, ENSRNOG00000003959: 78%
Entrez Gene ID: 64407
Uniprot ID: Q9NS28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
• Gene Sequence: LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
• Gene ID - Mouse: ENSMUSG00000026357
• Gene ID - Rat: ENSRNOG00000003959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.