Anti RFLNA pAb (ATL-HPA078021 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA078021-25

Protein Description: refilin A
Gene Name: RFLNA
Alternative Gene Name: Cfm2, FAM101A, FLJ44614, RefilinA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037962: 83%, ENSRNOG00000001011: 84%
Entrez Gene ID: 144347
Uniprot ID: Q6ZTI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRNY
• Gene Sequence: MLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRNY
• Gene ID - Mouse: ENSMUSG00000037962
• Gene ID - Rat: ENSRNOG00000001011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.