Anti RELT pAb (ATL-HPA071518)

Atlas Antibodies

SKU: ATL-HPA071518-25

• 

Protein Description: RELT tumor necrosis factor receptor
Gene Name: RELT
Alternative Gene Name: FLJ14993, TNFRSF19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008318: 92%, ENSRNOG00000025075: 86%
Entrez Gene ID: 84957
Uniprot ID: Q969Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE
• Gene Sequence: TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE
• Gene ID - Mouse: ENSMUSG00000008318
• Gene ID - Rat: ENSRNOG00000025075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.