Anti RDH16 pAb (ATL-HPA038518 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038518-100

Protein Description: retinol dehydrogenase 16 (all-trans)
Gene Name: RDH16
Alternative Gene Name: RODH-4, SDR9C8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089789: 54%, ENSRNOG00000004391: 54%
Entrez Gene ID: 8608
Uniprot ID: O75452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
• Gene Sequence: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
• Gene ID - Mouse: ENSMUSG00000089789
• Gene ID - Rat: ENSRNOG00000004391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RDH16 pAb (ATL-HPA038518 w/enhanced validation) – 1 Found

Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14.