Anti RBMS3 pAb (ATL-HPA034719 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034719-25

Protein Description: RNA binding motif, single stranded interacting protein 3
Gene Name: RBMS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039607: 94%, ENSRNOG00000025881: 94%
Entrez Gene ID: 27303
Uniprot ID: Q6XE24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
• Gene Sequence: MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
• Gene ID - Mouse: ENSMUSG00000039607
• Gene ID - Rat: ENSRNOG00000025881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.