Anti RBM43 pAb (ATL-HPA038204)

Atlas Antibodies

Catalog No.: ATL-HPA038204-25

Protein Description: RNA binding motif protein 43
Gene Name: RBM43
Alternative Gene Name: C2orf38, FLJ45645
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036249: 58%, ENSRNOG00000004673: 63%
Entrez Gene ID: 375287
Uniprot ID: Q6ZSC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTLVPETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNA
• Gene Sequence: RTLVPETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNA
• Gene ID - Mouse: ENSMUSG00000036249
• Gene ID - Rat: ENSRNOG00000004673
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.