Anti RBM27 pAb (ATL-HPA036422)

Atlas Antibodies

Catalog No.: ATL-HPA036422-25

Protein Description: RNA binding motif protein 27
Gene Name: RBM27
Alternative Gene Name: ARRS1, KIAA1311, Psc1, ZC3H18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024491: 95%, ENSRNOG00000027250: 95%
Entrez Gene ID: 54439
Uniprot ID: Q9P2N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTKNYLPLLEPVKPEPKPLVQEKEEIKEEVFQEPAEEERDGRKKKYPSPQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREK
• Gene Sequence: YTKNYLPLLEPVKPEPKPLVQEKEEIKEEVFQEPAEEERDGRKKKYPSPQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREK
• Gene ID - Mouse: ENSMUSG00000024491
• Gene ID - Rat: ENSRNOG00000027250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.