Anti RBBP6 pAb (ATL-HPA041725)

Atlas Antibodies

Catalog No.: ATL-HPA041725-25

Protein Description: retinoblastoma binding protein 6
Gene Name: RBBP6
Alternative Gene Name: P2P-R, PACT, SNAMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030779: 75%, ENSRNOG00000012806: 75%
Entrez Gene ID: 5930
Uniprot ID: Q7Z6E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD
• Gene Sequence: KATYDTKRPNEETKSVDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPD
• Gene ID - Mouse: ENSMUSG00000030779
• Gene ID - Rat: ENSRNOG00000012806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.