Anti RASSF9 pAb (ATL-HPA039678 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039678-25

Protein Description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 9
Gene Name: RASSF9
Alternative Gene Name: P-CIP1, PAMCI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044921: 80%, ENSRNOG00000038574: 82%
Entrez Gene ID: 9182
Uniprot ID: O75901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEY
• Gene Sequence: YRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEY
• Gene ID - Mouse: ENSMUSG00000044921
• Gene ID - Rat: ENSRNOG00000038574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.