Anti RASSF8 pAb (ATL-HPA038163)

Atlas Antibodies

Catalog No.: ATL-HPA038163-25

Protein Description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 8
Gene Name: RASSF8
Alternative Gene Name: C12orf2, HoJ-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030259: 84%, ENSRNOG00000015986: 82%
Entrez Gene ID: 11228
Uniprot ID: Q8NHQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIE
• Gene Sequence: TEFKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIE
• Gene ID - Mouse: ENSMUSG00000030259
• Gene ID - Rat: ENSRNOG00000015986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RASSF8 pAb (ATL-HPA038163) – 1 Found

Zhang, Lan; Wang, Jian-Hua; Liang, Rong-Xin; Huang, Shu-Ting; Xu, Jing; Yuan, Lin-Jing; Huang, Long; Zhou, Yun; Yu, Xing-Juan; Wu, Shao-Yun; Luo, Rong-Zhen; Yun, Jing-Ping; Jia, Wei-Hua; Zheng, Min. RASSF8 downregulation promotes lymphangiogenesis and metastasis in esophageal squamous cell carcinoma. Oncotarget. 2015;6(33):34510-24.