Anti RARS2 pAb (ATL-HPA042645)

Atlas Antibodies

Catalog No.: ATL-HPA042645-25

Protein Description: arginyl-tRNA synthetase 2, mitochondrial
Gene Name: RARS2
Alternative Gene Name: DALRD2, dJ382I10.6, MGC14993, MGC23778, PRO1992, RARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028292: 81%, ENSRNOG00000008643: 82%
Entrez Gene ID: 57038
Uniprot ID: Q5T160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQEFFQRLELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKG
• Gene Sequence: AQEFFQRLELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKG
• Gene ID - Mouse: ENSMUSG00000028292
• Gene ID - Rat: ENSRNOG00000008643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.