Anti RAPGEF3 pAb (ATL-HPA043518)

Atlas Antibodies

Catalog No.: ATL-HPA043518-25

Protein Description: Rap guanine nucleotide exchange factor (GEF) 3
Gene Name: RAPGEF3
Alternative Gene Name: bcm910, cAMP-GEFI, EPAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022469: 82%, ENSRNOG00000059961: 81%
Entrez Gene ID: 10411
Uniprot ID: O95398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQ
• Gene Sequence: TYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQ
• Gene ID - Mouse: ENSMUSG00000022469
• Gene ID - Rat: ENSRNOG00000059961
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.