Anti RALY pAb (ATL-HPA043614 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043614-25

Protein Description: RALY heterogeneous nuclear ribonucleoprotein
Gene Name: RALY
Alternative Gene Name: HNRPCL2, P542
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027593: 94%, ENSRNOG00000017405: 91%
Entrez Gene ID: 22913
Uniprot ID: Q9UKM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
• Gene Sequence: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
• Gene ID - Mouse: ENSMUSG00000027593
• Gene ID - Rat: ENSRNOG00000017405
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.