Anti RALGAPB pAb (ATL-HPA051454)

Atlas Antibodies

Catalog No.: ATL-HPA051454-25

Protein Description: Ral GTPase activating protein, beta subunit (non-catalytic)
Gene Name: RALGAPB
Alternative Gene Name: DKFZp781M2411, KIAA1219, RalGAPbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027652: 91%, ENSRNOG00000014836: 94%
Entrez Gene ID: 57148
Uniprot ID: Q86X10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
• Gene Sequence: LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
• Gene ID - Mouse: ENSMUSG00000027652
• Gene ID - Rat: ENSRNOG00000014836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.